PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta003861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 262aa    MW: 29522.1 Da    PI: 8.1817
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-1082547PU_refplantGDBView CDS
gnl|UG|Pta#S26637692PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.4e-19162216256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+++++++q   Lee F+knr p  ++++eLA +l+L  rqV vWFqNrRa+ k
  Pta003861 162 RKKHRLSRDQRALLEESFKKNRAPEPKQKQELALQLNLRPRQVEVWFQNRRARTK 216
                78999************************************************98 PP

2HD-ZIP_I/II104.68.1e-34162249188
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                  +kk+rls++q +lLEesF++++  ep++K+ela +L+l+prqv+vWFqnrRARtk kq+E+d+e++kr  +al++en++L+ e e+L+
    Pta003861 162 RKKHRLSRDQRALLEESFKKNRAPEPKQKQELALQLNLRPRQVEVWFQNRRARTKVKQIEVDCEVMKRYNEALADENRKLQMELEKLK 249
                  69************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-19158218IPR009057Homeodomain-like
SuperFamilySSF466891.09E-18158219IPR009057Homeodomain-like
PROSITE profilePS5007117.993158218IPR001356Homeobox domain
SMARTSM003896.4E-16160222IPR001356Homeobox domain
CDDcd000868.38E-18162219No hitNo description
PfamPF000461.0E-16162216IPR001356Homeobox domain
PROSITE patternPS000270193216IPR017970Homeobox, conserved site
SMARTSM003406.6E-13218261IPR003106Leucine zipper, homeobox-associated
PfamPF021839.7E-7218250IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGMNQDCNAD LSLGLGIRDG TITDEMYVSQ RNVSGPPLQL RLFPSAPDSD RDSLPWEKTT  60
PSIKAIGVGG EGSAGEAKVL IHPVAVTWRS DANKFPASYF YNEDAGAINV SLSNSSTVDS  120
NASNTGNGYT EIKRKWGYGE ELENELVWLT VLNDVEELGS SRKKHRLSRD QRALLEESFK  180
KNRAPEPKQK QELALQLNLR PRQVEVWFQN RRARTKVKQI EVDCEVMKRY NEALADENRK  240
LQMELEKLKP LKMSSPPLSP RX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210218RRARTKVKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NKN41e-71A9NKN4_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47370.11e-35Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein